Protein Info for DZA65_RS03595 in Dickeya dianthicola ME23

Annotation: copper/silver response regulator transcription factor SilR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 TIGR01387: heavy metal response regulator" amino acids 3 to 221 (219 residues), 317.3 bits, see alignment E=2.6e-99 PF00072: Response_reg" amino acids 3 to 113 (111 residues), 92.5 bits, see alignment E=1.9e-30 PF00486: Trans_reg_C" amino acids 146 to 221 (76 residues), 92 bits, see alignment E=2e-30

Best Hits

Swiss-Prot: 88% identical to CUSR_ECOLI: Transcriptional regulatory protein CusR (cusR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 95% identity to enc:ECL_01959)

Predicted SEED Role

"Copper-sensing two-component system response regulator CusR" in subsystem Cobalt-zinc-cadmium resistance or Copper homeostasis or Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CPF1 at UniProt or InterPro

Protein Sequence (226 amino acids)

>DZA65_RS03595 copper/silver response regulator transcription factor SilR (Dickeya dianthicola ME23)
MKILIVEDEIKTGEYLSKGLTEAGFVVDHADNGLTGYHLAMTAEYDLLILDIMLPDVNGW
DIIRMLRTAGKGMPVLLLSALGTIEHRVKGLELGADDYLVKPFAFAELLARVRTLLRRGS
TVISESQFKVADLTLDLVSRKVNRAGNRILLTSKEFSLLEFFIRHQGEVLPRSLIASQVW
DMNFDSDTNAIDVAVKRLRAKIDNDYEPKLIQTVRGVGYMLEIPDA