Protein Info for DZA65_RS03465 in Dickeya dianthicola ME23

Annotation: FAD assembly factor SdhE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 88 PF03937: Sdh5" amino acids 7 to 79 (73 residues), 88.3 bits, see alignment E=1.3e-29

Best Hits

Swiss-Prot: 89% identical to SDHE_SERS3: FAD assembly factor SdhE (sdhE) from Serratia sp. (strain ATCC 39006)

KEGG orthology group: K09159, hypothetical protein (inferred from 94% identity to dze:Dd1591_3430)

Predicted SEED Role

"YgfY COG2938"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CJ89 at UniProt or InterPro

Protein Sequence (88 amino acids)

>DZA65_RS03465 FAD assembly factor SdhE (Dickeya dianthicola ME23)
MDINNKSRIHWACRRGMRELDISIMPFFEHEYDTLSDDDKLHFIRLLQCDDPDLFNWLMN
HGEPVDPALKRMVSLIQTRNKDRGPVAM