Protein Info for DZA65_RS03340 in Dickeya dianthicola ME23

Annotation: adenine phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 PF00156: Pribosyltran" amino acids 35 to 168 (134 residues), 39 bits, see alignment E=2.6e-14

Best Hits

Swiss-Prot: 34% identical to HPRT_ACIB4: Hypoxanthine/guanine phosphoribosyltransferase (hpt) from Aciduliprofundum boonei (strain DSM 19572 / T469)

KEGG orthology group: K00759, adenine phosphoribosyltransferase [EC: 2.4.2.7] (inferred from 80% identity to dda:Dd703_2165)

Predicted SEED Role

"Adenine phosphoribosyltransferase (EC 2.4.2.7)" in subsystem Purine conversions or cAMP signaling in bacteria (EC 2.4.2.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.7

Use Curated BLAST to search for 2.4.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CXL8 at UniProt or InterPro

Protein Sequence (186 amino acids)

>DZA65_RS03340 adenine phosphoribosyltransferase (Dickeya dianthicola ME23)
MLLKDIYSNAKVVNSGKTLTTVNEFTDQLPALRPQVLIEVAYKIMSELDGNFDKIITEED
KGAPLATTLSLLTGKPLAMARWYPYSLSEYNNNVVDIKSEYFEGKMYLNGVEEGDRIVII
DDTLSTGGAVISLVEAVENAGGIITKIICAVEKIQNKGRDKVKNKTGHDVTTLIKIHVTE
NKVSVV