Protein Info for DZA65_RS03305 in Dickeya dianthicola ME23

Annotation: deoxyribose-phosphate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 TIGR00126: deoxyribose-phosphate aldolase" amino acids 12 to 232 (221 residues), 260.6 bits, see alignment E=4.5e-82 PF01791: DeoC" amino acids 14 to 225 (212 residues), 141.1 bits, see alignment E=2.3e-45

Best Hits

Swiss-Prot: 82% identical to DEOC_SERP5: Deoxyribose-phosphate aldolase (deoC) from Serratia proteamaculans (strain 568)

KEGG orthology group: K01619, deoxyribose-phosphate aldolase [EC: 4.1.2.4] (inferred from 95% identity to dze:Dd1591_3452)

MetaCyc: 77% identical to deoxyribose-phosphate aldolase (Escherichia coli K-12 substr. MG1655)
Deoxyribose-phosphate aldolase. [EC: 4.1.2.4]

Predicted SEED Role

"Deoxyribose-phosphate aldolase (EC 4.1.2.4)" in subsystem Deoxyribose and Deoxynucleoside Catabolism (EC 4.1.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D0K8 at UniProt or InterPro

Protein Sequence (259 amino acids)

>DZA65_RS03305 deoxyribose-phosphate aldolase (Dickeya dianthicola ME23)
MSDLTAAAQRALGLMDLTTLNDDDTDEKVTALCRQANSPAGKTAAICIYPRFVPLARKVL
REQGTPDVRIATVTNFPHGNDDIDIALAETHAAIAYGADDVDVVFPYRALMAGNRQVGFE
LVKACKSACAAAGVLLKVIIETGELKTDALIREASEIAIEAGADFIKTSTGKVAVNATLH
SADVMLSVIRDKGVGDRVGFKPAGGVRTAEDAADYLQLADAIMGDGWADARHFRFGASGL
LGSLLTTLGHAAGQARNGY