Protein Info for DZA65_RS03295 in Dickeya dianthicola ME23

Annotation: N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 PF00583: Acetyltransf_1" amino acids 18 to 122 (105 residues), 40.5 bits, see alignment E=3e-14 PF13508: Acetyltransf_7" amino acids 44 to 123 (80 residues), 35.6 bits, see alignment E=1e-12

Best Hits

Swiss-Prot: 68% identical to YHBS_ECO57: Uncharacterized N-acetyltransferase YhbS (yhbS) from Escherichia coli O157:H7

KEGG orthology group: K03824, putative acetyltransferase [EC: 2.3.1.-] (inferred from 95% identity to dze:Dd1591_3454)

Predicted SEED Role

"FIG002208: Acetyltransferase (EC 2.3.1.-)" in subsystem CBSS-214092.1.peg.3450 (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CAS5 at UniProt or InterPro

Protein Sequence (167 amino acids)

>DZA65_RS03295 N-acetyltransferase (Dickeya dianthicola ME23)
MLIRVEIPVDAPGIDALLRRAFPTSAEAELVHQLREDGQLTLGIVATDDEGGVIAYAAFS
PVTLGGEDRQWVALAPMAVEESQRRQGIGEQLVYEGLDALNEFGYTAVVVLGNRDYYARF
GFVPAAEQHLYCRWLGCEADFQVYPLADNHFEGASGLVEYAEPFNRF