Protein Info for DZA65_RS03205 in Dickeya dianthicola ME23
Annotation: phosphoglucosamine mutase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 92% identical to GLMM_PECCP: Phosphoglucosamine mutase (glmM) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)
KEGG orthology group: K03431, phosphoglucosamine mutase [EC: 5.4.2.10] (inferred from 98% identity to ddd:Dda3937_02345)MetaCyc: 87% identical to phosphoglucosamine mutase (Escherichia coli K-12 substr. MG1655)
Phosphoglucosamine mutase. [EC: 5.4.2.10]
Predicted SEED Role
"Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 5.4.2.10)
MetaCyc Pathways
- superpathway of anaerobic sucrose degradation (17/19 steps found)
- colanic acid building blocks biosynthesis (11/11 steps found)
- peptidoglycan recycling I (13/14 steps found)
- glycogen degradation I (8/8 steps found)
- O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
- D-galactose degradation I (Leloir pathway) (5/5 steps found)
- UDP-N-acetyl-D-glucosamine biosynthesis I (5/5 steps found)
- dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
- glycogen biosynthesis I (from ADP-D-Glucose) (4/4 steps found)
- UDP-α-D-glucose biosynthesis (2/2 steps found)
- sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
- glucose and glucose-1-phosphate degradation (4/5 steps found)
- sucrose degradation II (sucrose synthase) (4/5 steps found)
- sucrose biosynthesis II (6/8 steps found)
- starch degradation V (3/4 steps found)
- sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
- GDP-α-D-glucose biosynthesis (2/3 steps found)
- trehalose degradation V (2/3 steps found)
- glycogen degradation II (4/6 steps found)
- superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
- glucosylglycerol biosynthesis (3/5 steps found)
- starch degradation III (2/4 steps found)
- starch biosynthesis (6/10 steps found)
- chitin biosynthesis (5/9 steps found)
- CDP-6-deoxy-D-gulose biosynthesis (1/5 steps found)
- glycogen biosynthesis III (from α-maltose 1-phosphate) (2/8 steps found)
- CMP-legionaminate biosynthesis I (2/10 steps found)
- superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (8/19 steps found)
- superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (8/24 steps found)
- streptomycin biosynthesis (2/18 steps found)
- superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 5.4.2.10
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A3A4D9U6 at UniProt or InterPro
Protein Sequence (445 amino acids)
>DZA65_RS03205 phosphoglucosamine mutase (Dickeya dianthicola ME23) MSSRKYFGTDGIRGKVGDLPITPDFVLKLGWAAGKVLARHGSRKIIIGKDTRISGYMLES ALEAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSIDGTK LPDEVEEAIEAEMEKTLTCVESAELGKANRIVDAAGRYIEFCKGTFPSELSLSGLKIVVD CANGATYHIAPSVLRELGAQVIAIGCEPDGMNINEQCGATDVTQLQARVLSEKADVGLAF DGDGDRLIMVDHQGNKVDGDQILYIIAREALRQGQLRGGAVGTLMSNMGLELALKQLGVP FARAKVGDRYVLELMQSKGWRLGAENSGHVILLDKTTTGDGVIAGLQVLTAIVRNHMSLH DLCSGMKLFPQILVNVHFSGEGDPLESESVKQATQAVEEQLAGRGRVLLRKSGTEPLIRV MVEGEDEAMVMQMAHRIADAVKAAG