Protein Info for DZA65_RS02745 in Dickeya dianthicola ME23

Annotation: glycosyltransferase family 4 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 PF09314: DUF1972" amino acids 4 to 175 (172 residues), 35.9 bits, see alignment E=1.8e-12 PF13579: Glyco_trans_4_4" amino acids 18 to 175 (158 residues), 36.5 bits, see alignment E=1.8e-12 PF13439: Glyco_transf_4" amino acids 18 to 179 (162 residues), 63.4 bits, see alignment E=8.2e-21 PF20706: GT4-conflict" amino acids 192 to 304 (113 residues), 34.1 bits, see alignment E=4.8e-12 PF00534: Glycos_transf_1" amino acids 198 to 331 (134 residues), 87.6 bits, see alignment E=2.2e-28 PF13692: Glyco_trans_1_4" amino acids 200 to 333 (134 residues), 81.9 bits, see alignment E=1.7e-26

Best Hits

KEGG orthology group: None (inferred from 93% identity to ddd:Dda3937_02695)

Predicted SEED Role

"Alpha-D-GlcNAc alpha-1,2-L-rhamnosyltransferase (EC 2.4.1.-)" in subsystem Rhamnose containing glycans (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XXN7 at UniProt or InterPro

Protein Sequence (370 amino acids)

>DZA65_RS02745 glycosyltransferase family 4 protein (Dickeya dianthicola ME23)
MTTKITVLGTRGIPNVLGGVETHCQNLYPTIKKQFDVDICVIARSPYVNYKKSQYRGVMT
RALLAPKKRSLEAIVHSVLAAFITCFDQSTVVHVHAIGPGLVVPLLRLLGKKVVFTHHGP
DYDRQKWGFLAKRVLLLGEMVAVKYANEVIVISEVINDMIKQKYGRDDAHLIYNGVNPSQ
QLTPEVINQTLTRFSLQPQNYLVAVGRFVEEKGLHDLIAAYRQSGITIPLVLVGDADHPT
AYSMRLKQLADETPNVVLTGFLTGHELQTVFSQAKLFVMPSYHEGLPIALLEAMSFSLPV
VVSNIPANLEVNLAPDTYFKVGDVADLSEKIVQRSKSFSVDYSEYLQRYNWQKIAQQTMA
VYTSVNKSMS