Protein Info for DZA65_RS02730 in Dickeya dianthicola ME23

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 32 to 51 (20 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 123 to 142 (20 residues), see Phobius details amino acids 167 to 185 (19 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details amino acids 337 to 341 (5 residues), see Phobius details amino acids 361 to 383 (23 residues), see Phobius details amino acids 403 to 423 (21 residues), see Phobius details amino acids 427 to 447 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 94% identity to ddd:Dda3937_02641)

Predicted SEED Role

"FIG01200177: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XT33 at UniProt or InterPro

Protein Sequence (460 amino acids)

>DZA65_RS02730 hypothetical protein (Dickeya dianthicola ME23)
MSLNTGFYLQAYVIITLVFCGLTQYFTGVLAVLWLPFILALIMVGLLVMQTRYDALRLDT
QELVVLTLYLSFLAMAGVSTLLQGGITVTIVGFKNEVALSLIMFCLLLGFCRESQIYRVT
RSLYWVFYAQFPVVIYQVLFVLPRRVALRGEDEKWDSVVGTFGGDPLGGGNTAAMGLFCL
LIMLLKVSEFKHGLTSLNSTALHIILGFGLCILGEVKFVILVSPLLLAWVWLMPSYIKGM
RSVNLKAILLIFIGMALLITVAITILASGYSSAFGSDPTKSAMSVFLDSLNYIFDTDYIM
ESGELGRLTTIFFWLKNNDMWGLSGTLFGYGLNATNSGSAVSPGFLNIIYNLIIDSTSLS
VLLWEVGVIGSLFFIGLIIYILIIVQPKPVLERNEIDQQDLQLLSFSPAFNVFAVGCLLS
LPYSQILMIIPMLQFLFYLSLGSSLVIRHSVRCYIGKPYE