Protein Info for DZA65_RS02705 in Dickeya dianthicola ME23

Annotation: undecaprenyl-phosphate glucose phosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 81 to 104 (24 residues), see Phobius details amino acids 118 to 136 (19 residues), see Phobius details amino acids 283 to 306 (24 residues), see Phobius details TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 20 to 468 (449 residues), 438.3 bits, see alignment E=4.2e-135 TIGR03023: undecaprenyl-phosphate glucose phosphotransferase" amino acids 28 to 468 (441 residues), 518.3 bits, see alignment E=2.5e-159 PF13727: CoA_binding_3" amino acids 79 to 242 (164 residues), 76.6 bits, see alignment E=2.5e-25 PF02397: Bac_transf" amino acids 278 to 460 (183 residues), 224.9 bits, see alignment E=5.7e-71

Best Hits

KEGG orthology group: K03606, putative colanic acid biosysnthesis UDP-glucose lipid carrier transferase (inferred from 95% identity to ddd:Dda3937_02646)

Predicted SEED Role

"Capsular polysaccharide synthesis enzyme CpsA, sugar transferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XT15 at UniProt or InterPro

Protein Sequence (468 amino acids)

>DZA65_RS02705 undecaprenyl-phosphate glucose phosphotransferase (Dickeya dianthicola ME23)
MSSNQIRISYGNDFFIIKLMDFLSINLTLIVSARLFLMGAFDDVIMISLLFSTSFLLIGE
YTGLYHHGLKNMQFRGQRRLWSSAFLSVIFVEVVRSYAGTLYSLGLLHHLDNIYFSATLY
WYILSLCGLCLTRFITFKFTTKKRMRIAIVGLTPGGLAAEKALLKEYANMQLELAFYDDR
SPSRCGYLFKSPFNGKVSELVEEAKAGRVDEIYIALPMIALKRIRYFLSIMSDTTVDTYI
IPDLYSYSSYVSQFRSINNIQTLSIFRSPFDGIGSVIKRVEDLVIGGVITLMISPLLLLI
AVGIKLTSRGPVLFKQDRYGLSGNKIKVWKFRSMHVMENAGVVTQATKNDPRVTRFGAFL
RRTSLDELPQFFNVLQGTMSIIGPRPHAVVHNEQYRQLVENYMIRHKVKPGISGLAQVNG
YRGEVDTLDKMEKRVHYDIAYIQSWSLWLDIKIIFRTIFKGFIGENAY