Protein Info for DZA65_RS02700 in Dickeya dianthicola ME23

Annotation: L-talarate/galactarate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 94% identical to TAGAD_SALTY: L-talarate/galactarate dehydratase (STM3697) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 98% identity to ddd:Dda3937_02647)

Predicted SEED Role

"Mandelate racemase (EC 5.1.2.2)" (EC 5.1.2.2)

MetaCyc Pathways

mandelate degradation I (1/5 steps found)
4-hydroxymandelate degradation (1/6 steps found)
mandelate degradation to acetyl-CoA (4/18 steps found)
superpathway of aromatic compound degradation via 3-oxoadipate (7/35 steps found)
superpathway of aromatic compound degradation via 2-hydroxypentadienoate (7/42 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XSX4 at UniProt or InterPro

Protein Sequence (399 amino acids)

>DZA65_RS02700 L-talarate/galactarate dehydratase (Dickeya dianthicola ME23)
MSLSANSDAVSYASVTGVKTAAETGDRIEWVKLSLALLPLATPVSDAKVLTGRQKPLTEV
AIIIAEIRSRDGFEGVGFSYSKRAGGQGIYAHAKEIADNLLGEDPNDIDKIYSKLLWAGA
SVGRSGMAVQAISPLDIALWDMKAKRAGLPLAKLLGAHRDSVQCYNTSGGFLHTPLEQVL
KNVAFSRESGIGGIKLKVGQPNTAEDIRRLTAVREALGDDFPLMVDANQQWDRETAIRMG
RKMEAFNLIWIEEPLDAYDIEGHAQLAAALDTPIATGEMLTSFREHEQLILGNASDVVQP
DAPRVGGISPFLKIMDLAAKHGRKLAPHFAMEVHVHLAAAYPLEPWLEHFEWLNPLFNEQ
LELRDGRMWVSDRHGLGFTLSEQARKWTQLSCEFGKYAG