Protein Info for DZA65_RS02675 in Dickeya dianthicola ME23

Annotation: Gfo/Idh/MocA family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 PF01408: GFO_IDH_MocA" amino acids 1 to 115 (115 residues), 55.8 bits, see alignment E=1.1e-18 PF22725: GFO_IDH_MocA_C3" amino acids 133 to 286 (154 residues), 49 bits, see alignment E=9.1e-17 PF02894: GFO_IDH_MocA_C" amino acids 142 to 365 (224 residues), 50.8 bits, see alignment E=3e-17

Best Hits

KEGG orthology group: None (inferred from 80% identity to pao:Pat9b_0365)

Predicted SEED Role

"Small Molecule Metabolism"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XT26 at UniProt or InterPro

Protein Sequence (383 amino acids)

>DZA65_RS02675 Gfo/Idh/MocA family oxidoreductase (Dickeya dianthicola ME23)
MKVGIVGLGFRLSNVVKEFLKADPDFSIVGYADPAPAGLPGLQQAGIDVGTAFDSLQALL
AAGGFDMLMVGSPNFMHLEHIRQGLQAGYTVFTEKPVVIDEAQTLALAELVRQYGAERIL
VGLVLRYSPLYQDLLAARDASQLGEITSIEATEHIRPYHGAFFMRDWRRYECYAGPYILE
KCCHDIDLYQGLVGQRPVRVASFGGRKSFTPLHAPHGDITPTSEVYHVKPSGWSSTDAVF
ESDADIVDYQTAIVEYAGGATLSFHANLNVPDEFRRFCVIGTDGMAEGDFVRNFFRVHDA
RTGDKKTDKAYEGNAYDGHYGADTLMAEEIVQHFRQGTPLKVSVIDALEAGLTAIKIDEA
RKTRSVIDLSDSWARFDACLGRV