Protein Info for DZA65_RS02640 in Dickeya dianthicola ME23

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 68 to 94 (27 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 134 to 157 (24 residues), see Phobius details amino acids 178 to 202 (25 residues), see Phobius details amino acids 234 to 257 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 81 to 259 (179 residues), 66.1 bits, see alignment E=1.8e-22

Best Hits

Swiss-Prot: 32% identical to YURM_BACSU: Probable ABC transporter permease protein YurM (yurM) from Bacillus subtilis (strain 168)

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 82% identity to pam:PANA_0321)

Predicted SEED Role

"probable sugar ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CRF0 at UniProt or InterPro

Protein Sequence (271 amino acids)

>DZA65_RS02640 carbohydrate ABC transporter permease (Dickeya dianthicola ME23)
MSTPPAFWRVLIWIVALMTVLPFGLALMTSFKTQTELFQGIFTLPSRFNLDNYLTAWQQG
HFNLYFMNSILVVVPVVISSLLLGILSGFGFAFLRIPGKRLFAAALALGMVLPSEAFIIP
LYHELHWLGLTNSYLALILPQVALSMPFATLMIASAFQQVPRELLEASVMDGAPRLKILW
GILVPAIWPMLSTLALLLFIWTWNEFLIPLILVNRDELRTLPIGMMFFQNKNTINIPVLM
AGAMIVILPLIAIFLCFQRKFISGVTEGAVK