Protein Info for DZA65_RS02610 in Dickeya dianthicola ME23

Annotation: FAD-dependent urate hydroxylase HpxO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF01494: FAD_binding_3" amino acids 2 to 337 (336 residues), 104.4 bits, see alignment E=1.1e-33 PF13450: NAD_binding_8" amino acids 5 to 34 (30 residues), 29 bits, see alignment (E = 1.6e-10)

Best Hits

Swiss-Prot: 73% identical to HPXO_KLEP7: FAD-dependent urate hydroxylase (hpxO) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 84% identity to dze:Dd1591_3565)

MetaCyc: 73% identical to FAD-dependent urate hydroxylase (Klebsiella pneumoniae)
RXN-11186 [EC: 1.14.13.113]

Predicted SEED Role

"Salicylate hydroxylase (EC 1.14.13.1)" in subsystem Salicylate and gentisate catabolism or Salicylate ester degradation (EC 1.14.13.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.1 or 1.14.13.113

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XTL1 at UniProt or InterPro

Protein Sequence (384 amino acids)

>DZA65_RS02610 FAD-dependent urate hydroxylase HpxO (Dickeya dianthicola ME23)
MKALVIGAGIGGLCAAAALKKAGIDCEVFEAVTDIKPVGAAISVWPNGVKCMRSLGMGDI
LDRGGGPMHDMAYQDGRRGDTLTRFSLQPLVEQVGERPCPVARAELQGQMLDHWGRDRVQ
FGKRVSQVEEQGGTVRATFTDGTAAHGDLLIAADGAHSAVRPYVLGHTPVRRYAGYVNWN
GLVAIDESIAPARQWTTFVGEGKRVSLMPVANGRFYFFFDVPLPAGLAEDRHSAREDLRR
YFDGWCAPVQRLIAQLEPDAINRIEIHDMDPVERLARGRVALLGDAGHSTTPDIGQGGCA
AMEDAVVLGQALAGHRPVEAALRQYEHQRLDRVRDLVLKARKRCDLTHGNVWEQTQAWYQ
ELRQETGDRIIAGLRDTILGGPLG