Protein Info for DZA65_RS02590 in Dickeya dianthicola ME23

Annotation: 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03180: OHCU decarboxylase
  • amino acids 7 to 164 (158 residues), 179.2 bits, E=3.1e-57
• PF09349: OHCU_decarbox
  • amino acids 9 to 161 (153 residues), 137.7 bits, E=2.5e-44

Best Hits

KEGG orthology group: None (inferred from 95% identity to ddd:Dda3937_02651)

MetaCyc: 57% identical to OHCU decarboxylase (Klebsiella pneumoniae pneumoniae MGH 78578)
RXN-6201 [EC: 4.1.1.97]

Predicted SEED Role

"Uricase (EC 1.7.3.3)" (EC 1.7.3.3)

MetaCyc Pathways

• ureide biosynthesis (6/7 steps found)
• urate conversion to allantoin I (3/3 steps found)
• urate conversion to allantoin II (3/3 steps found)
• urate conversion to allantoin III (2/3 steps found)
• superpathway of purines degradation in plants (11/18 steps found)

KEGG Metabolic Maps

• Caffeine metabolism
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.3.3 or 4.1.1.97

Sequence Analysis Tools

See A0A3A4CQ05 at UniProt or InterPro

Protein Sequence (166 amino acids)

>DZA65_RS02590 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (Dickeya dianthicola ME23)
MITLEQFNLLSVSEAVALLTPCVILPGWAKQVTAGRPYGNRAALLAAGLKATQGWQEEEL
AQALRTHPRIGEPAHGATPEAGLSRQEQAAVRTNDNTLTNALRAGNARYESHFGRVFLIR
AKGRSGEEILHILHRRLQNTPQQETAEALEQLRQITLLRLEGTIGE