Protein Info for DZA65_RS02560 in Dickeya dianthicola ME23

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 64 to 82 (19 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 120 to 143 (24 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 178 to 193 (16 residues), see Phobius details amino acids 200 to 218 (19 residues), see Phobius details amino acids 241 to 271 (31 residues), see Phobius details amino acids 283 to 305 (23 residues), see Phobius details amino acids 311 to 330 (20 residues), see Phobius details PF01032: FecCD" amino acids 17 to 331 (315 residues), 288.7 bits, see alignment E=2.4e-90

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 92% identity to ddd:Dda3937_02657)

Predicted SEED Role

"ABC transporter (iron.B12.siderophore.hemin) , permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XTK6 at UniProt or InterPro

Protein Sequence (332 amino acids)

>DZA65_RS02560 iron ABC transporter permease (Dickeya dianthicola ME23)
MRAHRHYALVCLLVLTLLLAMMLLSTAVGAIRIPLAQVLAALMPHHGDAPDSVYRIVLEL
RLPRTLLAAATGAGLAMVGALLQTTTRNDLADPFLFGLSSGASAGAVLVITRFGEWFGAF
TLPVAAFGGGMCSALAVMLLFFLRQRRQAEHLVICGLAISFLFGALTSYLAFSGDQRAAG
SVLFWSLGGLGLARWENLPIALGSLTLLGGLLLTRWRALDGLLAGEQTAASLGVHVNRLR
VEVFLCCALATALLVSLTGVIGFVGLMVPHLCRPLAGARHRRLIPLCGLLGAALLCGGDI
LSRVLLPSQELPVGIVTAGLGGAFVIALLAKR