Protein Info for DZA65_RS02535 in Dickeya dianthicola ME23

Annotation: HAMP domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 568 transmembrane" amino acids 23 to 47 (25 residues), see Phobius details amino acids 204 to 227 (24 residues), see Phobius details PF02203: TarH" amino acids 16 to 190 (175 residues), 110.7 bits, see alignment E=1.2e-35 PF00672: HAMP" amino acids 227 to 277 (51 residues), 45.3 bits, see alignment 1.3e-15 PF00015: MCPsignal" amino acids 341 to 497 (157 residues), 195.3 bits, see alignment E=1.1e-61

Best Hits

Swiss-Prot: 57% identical to MCP3_ECOLI: Methyl-accepting chemotaxis protein III (trg) from Escherichia coli (strain K12)

KEGG orthology group: K05876, methyl-accepting chemotaxis protein III, ribose and galactose sensor receptor (inferred from 96% identity to ddd:Dda3937_02665)

Predicted SEED Role

"Methyl-accepting chemotaxis protein III (ribose and galactose chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CZC6 at UniProt or InterPro

Protein Sequence (568 amino acids)

>DZA65_RS02535 HAMP domain-containing protein (Dickeya dianthicola ME23)
MNTTALSPSSPGVSFWHHWRLMPMFSSIIGVILILFALAIGFSVHFLMRSNSSLNDVTAE
IQVRLGVSNSSNHLRTARLMLIQAAAAAKEGDKDTASSSIQQAEGRLKQSADSFAAYQSR
EVKTPADLALDDALQQRYNDYVNNGVRPMLDAVKAGRYDDVVATEWKQTRKLDLAYNEVL
LKVVAIRTQRAEALNNGAQQESVLGYSVMAASFVVAVLVSLFTYLCLRRVIIKPMRSLVE
RIEHIASGNLTMPLAQWGRGEVGQLGQYLQNMQQSLARTVSNVRHGVDAIYQGITEISAG
NSDLSSRTEEQASALEQTASSMEELTSTVRHNADNANHASQLAGDASGKARHGGELVDSV
VKTMGNIHQSSKKISEITNIINGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRSLA
QRSAQAAKEIEGLITESVALVETGSGQVSRAGETMQDIVNAVTSVTDIMAEISVASQEQS
KGIDQVGQAINSIDNVTQQNAALVEQATAAATSLAEQAAGLNEAVSAFRIDGVERRPAIS
IAARPASVQAALPGAKKAKISNDGWETF