Protein Info for DZA65_RS02420 in Dickeya dianthicola ME23

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 81 to 105 (25 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 144 to 160 (17 residues), see Phobius details amino acids 199 to 224 (26 residues), see Phobius details amino acids 244 to 266 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 96 to 276 (181 residues), 83.3 bits, see alignment E=9.1e-28

Best Hits

Swiss-Prot: 37% identical to DDPC_ECOLI: Probable D,D-dipeptide transport system permease protein DdpC (ddpC) from Escherichia coli (strain K12)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 97% identity to ddd:Dda3937_03673)

MetaCyc: 35% identical to murein tripeptide ABC transporter / oligopeptide ABC transporter inner membrane subunit OppC (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]; 7.4.2.6 [EC: 7.4.2.6]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XST3 at UniProt or InterPro

Protein Sequence (279 amino acids)

>DZA65_RS02420 ABC transporter permease (Dickeya dianthicola ME23)
MPTPYRTAYRSPWLAPATLLPATAVLLLLLAVFFPALFTHLLPDEMDMEAVLQPPGANHW
FGTDTLGRDVFTRVVYGTSLSLSIGVGAMLIACLGGVLLGTLSALAPLPVRRVLVRLLDI
MLAFPEMLLALLVIAVLGRGPENTLLAVGLAGVAGYARLVRSQVLQVKLSGYVEHAVALG
EHPLYIVVRHIIPNTLRPLLILATIGVGNAVLSASALSFLGLGVVPPTAEWGALLADGRN
FLDIAPWVSLFPASVVALSVIVITLLGRRLQAMLAKGAA