Protein Info for DZA65_RS02415 in Dickeya dianthicola ME23

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 566 PF00005: ABC_tran" amino acids 30 to 193 (164 residues), 88.7 bits, see alignment E=1.1e-28 amino acids 325 to 476 (152 residues), 118.5 bits, see alignment E=6.9e-38 PF08352: oligo_HPY" amino acids 243 to 281 (39 residues), 25.3 bits, see alignment 3.2e-09 amino acids 528 to 555 (28 residues), 25 bits, see alignment (E = 4e-09)

Best Hits

KEGG orthology group: None (inferred from 96% identity to ddd:Dda3937_03674)

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppD (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XUS6 at UniProt or InterPro

Protein Sequence (566 amino acids)

>DZA65_RS02415 ABC transporter ATP-binding protein (Dickeya dianthicola ME23)
MSQSASQPLLRVEGLNVTFPSPHGPVESVRNLSFQVNPGEILALVGESGSGKSVTARTLV
GLAGERAQIQANAIELVRHDGSRCNLQTLSDRQWQQVRGREIGFVLQDALVSLDPLRRIG
QEVAEPLLTHKLASRSDVAARVAELLVQVGIPDPANRAAQYPHELSGGLRQRALIASALA
AGPKLLIADEPTTALDATVQQQVLKLFTALAQAGHGVLLITHDLAVVSQVADQVMVMQNG
ALVERGAARQVLSAPQHPYTRRLLAAIPTAATRGNWLAGENPLSQQASTLLSSAGEPGEK
SGLALQVDGVSVSFKRPDGSRMTAVNNISLTVERGETLGIVGESGSGKTTLGKVILALQP
PDSGDILLSGKPWSALSERERRPLRARIQTITQDPLSSFDPQFTIEQLLLQPLRLRRDLS
PQARQQRILALLELVGLSPTLLARRPQSLSGGQRQRISIAQALAAEPEVLVCDEPVSALD
VTTQAQVLDLLVALQQRLHLSMVFISHDLGVVQHMSHRIAVMKDGNVVERGTVEQIFNQP
QHPYTRQLLSTVAPVVINRQNNDIYA