Protein Info for DZA65_RS02165 in Dickeya dianthicola ME23

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 PF13673: Acetyltransf_10" amino acids 29 to 147 (119 residues), 33.5 bits, see alignment E=5.9e-12 PF00583: Acetyltransf_1" amino acids 37 to 144 (108 residues), 29.9 bits, see alignment E=8.8e-11 PF13508: Acetyltransf_7" amino acids 43 to 145 (103 residues), 38.7 bits, see alignment E=1.7e-13

Best Hits

KEGG orthology group: None (inferred from 99% identity to dda:Dd703_3543)

Predicted SEED Role

"FIG001353: Acetyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CFP3 at UniProt or InterPro

Protein Sequence (159 amino acids)

>DZA65_RS02165 GNAT family N-acetyltransferase (Dickeya dianthicola ME23)
MGITAPELLLPQHAVVDFHCSEPSLNEWLKRKALKNQTLGASRTFVVCEAGTQRVVGFYA
LASGSIQRQVAPGAFRRNMPDPIPVLVLGRLAVDERYQRMGIGAGLLKDAVLRSRNVAQQ
VGNKALLVHALSDEAKAFYQYWGFVPSEIQEHTLLLSLW