Protein Info for DZA65_RS02105 in Dickeya dianthicola ME23

Annotation: AAA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 681 PF08273: Zn_Ribbon_Prim" amino acids 31 to 67 (37 residues), 68.7 bits, see alignment 6.3e-23 PF13362: Toprim_3" amino acids 204 to 301 (98 residues), 43.3 bits, see alignment E=6.1e-15 PF13481: AAA_25" amino acids 344 to 518 (175 residues), 154.3 bits, see alignment E=4.7e-49

Best Hits

KEGG orthology group: K06919, putative DNA primase/helicase (inferred from 99% identity to dze:Dd1591_3707)

Predicted SEED Role

"Replicative helicase RepA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XSN0 at UniProt or InterPro

Protein Sequence (681 amino acids)

>DZA65_RS02105 AAA family ATPase (Dickeya dianthicola ME23)
MSKFVSESVAQSRHRWPSILAALDIYFPAGGQHGPCPVCGGKDRFRFDDKRGRGTWFCNH
CGHGDGLDLVARVRRCDIAEAARVVTALASSASETPPAREKTVDPRPLAERIKALMAAAS
TGESPYLKARGLMTPAMLLTAAKAMTIGRVRFGEGSLLLPMFRTSGELAGAQLITPGGEK
RLYPGTQLKGAFIPVNHGPEPSKLIITEGYATALTLQQCSSCHVVAAVSANNLLNVAQAF
RARYPHCCLILAGDNDIHPDGAANTGKLMAEKAALAVDGWVALPPTDTACDWDDFRQRHG
MEATKAAFRRQLTRPAVISPAPLPDAGPSPVTAFSSALPLRKGSEGFDTRQDYLIKGYLP
SGAVASAYGASGSYKSFLAVSWACHIATGKPWANRPVTQGAVIYVVGEGGIGVPRRIRAW
EETLNDRSPIDALYRVDCPVFPASPDSVEQVIKAAHDVQAATGMVVRLIILDTLARCFGG
SDENAAKDMGAFIQGCDYIKAATQATVLIIHHSGKDQDKGARGSSAFRAALDVEFNVRRE
ADGQALILTCTKMKDAEEPPRRAYDLTAVNLYVDDDGEPVTSLVLRDEGREVRDDPTDAD
PALSGITRLTDNHVALWEAIRSRTASGDGCTRALVRDDMRAMGFDVSKKFTRWLDKLVKD
DLIALDGENIVPLSKRGNVGE