Protein Info for DZA65_RS02055 in Dickeya dianthicola ME23

Annotation: DNA polymerase III subunit chi

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 PF04364: DNA_pol3_chi" amino acids 1 to 154 (154 residues), 135.2 bits, see alignment E=8.9e-44

Best Hits

Swiss-Prot: 71% identical to HOLC_ECOLI: DNA polymerase III subunit chi (holC) from Escherichia coli (strain K12)

KEGG orthology group: K02339, DNA polymerase III subunit chi [EC: 2.7.7.7] (inferred from 98% identity to ddd:Dda3937_01297)

MetaCyc: 71% identical to DNA polymerase III subunit chi (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA polymerase III chi subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XSS6 at UniProt or InterPro

Protein Sequence (161 amino acids)

>DZA65_RS02055 DNA polymerase III subunit chi (Dickeya dianthicola ME23)
MKNATFYLIDHESLIDHESLIDHDRPSGELNACEALACSLAAARWRAGQRVLIACEDEQQ
AFRLDEALWQREPHAFVPHNLAGEGPRQGAPVELAWPQKRSNAPRDLLISLQPQFADFAT
AFHEVIDFVPYEESLKQLARDRYKAYRSVGFQLTTATPPTH