Protein Info for DZA65_RS01965 in Dickeya dianthicola ME23

Annotation: aspartate carbamoyltransferase regulatory subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 TIGR00240: aspartate carbamoyltransferase, regulatory subunit" amino acids 5 to 151 (147 residues), 217.8 bits, see alignment E=2.9e-69 PF01948: PyrI" amino acids 7 to 96 (90 residues), 105.8 bits, see alignment E=1.1e-34 PF02748: PyrI_C" amino acids 102 to 150 (49 residues), 69.2 bits, see alignment E=2.2e-23

Best Hits

Swiss-Prot: 92% identical to PYRI_PECCP: Aspartate carbamoyltransferase regulatory chain (pyrI) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K00610, aspartate carbamoyltransferase regulatory subunit (inferred from 97% identity to ddd:Dda3937_01283)

MetaCyc: 76% identical to aspartate carbamoyltransferase, PyrI subunit (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Aspartate carbamoyltransferase regulatory chain (PyrI)" in subsystem De Novo Pyrimidine Synthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D782 at UniProt or InterPro

Protein Sequence (154 amino acids)

>DZA65_RS01965 aspartate carbamoyltransferase regulatory subunit (Dickeya dianthicola ME23)
MTHDNKLQVEAIKRGTVIDHIPAQVGFKLLTLFKLTATDQRITIGLNLPSNHLGRKDLIK
IENIFLTEEQANQLAMYAPQATVNQIDNYDVVRKLRPQLPSHIEGVLTCPNSNCISRSEP
VNSSFGVKQRGDDVQLKCKYCEKEFERQAVLNSH