Protein Info for DZA65_RS01865 in Dickeya dianthicola ME23

Annotation: HAMP domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details PF02203: TarH" amino acids 2 to 170 (169 residues), 36.7 bits, see alignment E=8.3e-13 PF12729: 4HB_MCP_1" amino acids 3 to 174 (172 residues), 63.1 bits, see alignment E=5.1e-21 PF00672: HAMP" amino acids 208 to 258 (51 residues), 43.9 bits, see alignment 4.8e-15 PF00015: MCPsignal" amino acids 321 to 477 (157 residues), 185.9 bits, see alignment E=1.1e-58

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 84% identity to ddc:Dd586_0356)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CZR4 at UniProt or InterPro

Protein Sequence (558 amino acids)

>DZA65_RS01865 HAMP domain-containing protein (Dickeya dianthicola ME23)
MKNYKIGIRLSVGFGVLIAFSLVMMASGIYQLRQISQNAEKIMQIPLQKERLVADWGATL
AAGIQRATATARSSDASLAQVFAADNANATKENNERAAKFTALVSLNEEKALLDKLNIDR
QAYIKARDDIFAAKAAGNAEQAKQLFEQQLQPISVAYQKSMNLLRDYQRTSIDQMRTDIA
ERANNSYLFLGGLGVLITAIGSLLAWMLTHSIVQPLQKAVQVTHAVARGELTDDISPQGR
DELAQLQHALQEMTAQLRTVVGEVREGAEAIADASSQLSAGNQDLSNRTDEQSGALQETA
ASIEQLTSTVRQNADNARQASQLAQDTASQAQSGGQLVSEVVQTMGAIDSSSKKIVDIIG
VIDSIAFQTNILALNAAVEAARAGEQGRGFAVVASEVRSLAQRSASAAREIKELIGHSVQ
TVDAGNRLVEKAGVSIQGIVDGVRKVSELVGEISVASQEQSLGIEQVNMAINKMEQTTLQ
NASLVREGTTATQALQQQAEQLKQVVGIFHLEKARPDAYRVSGSRPMLAASPATKTLALK
PAASSRKASASEDDWQAF