Protein Info for DZA65_RS01835 in Dickeya dianthicola ME23

Annotation: LacI family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 TIGR02417: D-fructose-responsive transcription factor" amino acids 8 to 319 (312 residues), 401.5 bits, see alignment E=1.4e-124 PF00356: LacI" amino acids 8 to 56 (49 residues), 54.6 bits, see alignment 1.5e-18 PF00532: Peripla_BP_1" amino acids 68 to 241 (174 residues), 33.2 bits, see alignment E=8.1e-12 PF13407: Peripla_BP_4" amino acids 71 to 316 (246 residues), 35.8 bits, see alignment E=1.3e-12 PF13377: Peripla_BP_3" amino acids 180 to 334 (155 residues), 53.9 bits, see alignment E=4.7e-18

Best Hits

Swiss-Prot: 65% identical to SCRR_KLEPN: Sucrose operon repressor (scrR) from Klebsiella pneumoniae

KEGG orthology group: K03484, LacI family transcriptional regulator, sucrose operon repressor (inferred from 97% identity to ddd:Dda3937_01265)

Predicted SEED Role

"Sucrose operon repressor ScrR, LacI family" in subsystem Sucrose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XSI1 at UniProt or InterPro

Protein Sequence (343 amino acids)

>DZA65_RS01835 LacI family DNA-binding transcriptional regulator (Dickeya dianthicola ME23)
MKQTKRVTISDIAQLAGVSKSTASLVLNGRSKEFRVSDETRDRVLALAQQHRYQPSIHAR
SLRSSRSNTLGLVVPEMTNYGFAMISRELECLCREAGLQLLIACTDENASQEMMAVNSLI
QRQVDGLIVASSMLNDAEYQKINQQLPVLQFDRVIGESDLPMVVCEAVESTAMLVENIAR
RHPDEFYFIGGPPRISPTRDRLAGFQLGLERAGVECRPEWIIHGNYHSSAGYEMFAQLCA
RLGRPPKALFTAACGLLEGVLRYLNQHNLMDCDMRLCSFDDHYLFDCLPLKIDTVAQDCE
TLARNSFEMINALIEGQPLTESRVYVPTRPHWRHPDSRADTHR