Protein Info for DZA65_RS01735 in Dickeya dianthicola ME23

Annotation: DNA topoisomerase IV subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 631 TIGR01055: DNA topoisomerase IV, B subunit" amino acids 5 to 626 (622 residues), 1180.8 bits, see alignment E=0 PF02518: HATPase_c" amino acids 29 to 171 (143 residues), 52.7 bits, see alignment E=1.1e-17 PF00204: DNA_gyraseB" amino acids 219 to 385 (167 residues), 139.3 bits, see alignment E=1.9e-44 PF01751: Toprim" amino acids 414 to 523 (110 residues), 46.6 bits, see alignment E=6.4e-16 PF00986: DNA_gyraseB_C" amino acids 557 to 621 (65 residues), 81.9 bits, see alignment E=5.8e-27

Best Hits

Swiss-Prot: 91% identical to PARE_SALTI: DNA topoisomerase 4 subunit B (parE) from Salmonella typhi

KEGG orthology group: K02622, topoisomerase IV subunit B [EC: 5.99.1.-] (inferred from 99% identity to ddd:Dda3937_01251)

Predicted SEED Role

"Topoisomerase IV subunit B (EC 5.99.1.-)" in subsystem DNA topoisomerases, Type II, ATP-dependent or Resistance to fluoroquinolones (EC 5.99.1.-)

Isozymes

Compare fitness of predicted isozymes for: 5.99.1.-

Use Curated BLAST to search for 5.99.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CPL7 at UniProt or InterPro

Protein Sequence (631 amino acids)

>DZA65_RS01735 DNA topoisomerase IV subunit B (Dickeya dianthicola ME23)
MTQSSYNADAIEVLSGLEPVRRRPGMYTDTTRPNHLGQEVIDNSVDEALAGHARRIDVIL
HPDQSLEVIDDGRGMPVDIHPEEGVPAVELILCRLHAGGKFSNKNYQFSGGLHGVGISVV
NALSTRVEVTVRRDGQVYDIAFENGDKVQDLTVTGTCGRRNTGTRVHFWPDVTFFDSPRF
SVLSLTHLLKAKAVLCPGVEIVFKDGVNDTEQRWCYQGGLSDYLCEAVNGLPTLPEKPFI
GVIPGDTEAVEWALLWLPEGGELLTESYVNLIPTLQGGTHVNGLRQGLLDAMREFCEFRN
ILPRGVKLSAEDIWERCAYVLSLKMQDPQFAGQTKERLSSRQSAAFVSGVVKDAFSLWLN
QNVQAAEQLAEMAISSAQRRMRAAKKVVRKKLTSGPALPGKLADCTLQDLNKTELFLVEG
DSAGGSAKQARDREYQAIMPLKGKILNTWEVSSDEVLASQEVHDISVAIGIDPDSDDLSQ
LRYGKVCILADADSDGLHIATLLCALFVRHFRALVQGGHVHVAMPPLYRIDLGKEVYYAL
DEEEKAGILEQLKRKKGKPNVQRFKGLGEMNPMQLRETTLDPNTRRLVQLTINEQDIEQT
LATMDMLLAKKRAEDRRNWLQEKGDKAELDV