Protein Info for DZA65_RS01670 in Dickeya dianthicola ME23

Annotation: DnaA initiator-associating protein DiaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 PF13580: SIS_2" amino acids 14 to 144 (131 residues), 102.1 bits, see alignment E=2.7e-33 PF01380: SIS" amino acids 102 to 167 (66 residues), 25.4 bits, see alignment E=1.1e-09

Best Hits

Swiss-Prot: 97% identical to DIAA_PECCP: DnaA initiator-associating protein DiaA (diaA) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K12961, DnaA initiator-associating protein (inferred from 100% identity to dze:Dd1591_3784)

MetaCyc: 41% identical to D-sedoheptulose 7-phosphate isomerase (Aneurinibacillus thermoaerophilus)
RXN0-4301 [EC: 5.3.1.28]

Predicted SEED Role

"Phosphoheptose isomerase (EC 5.3.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 5.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.-, 5.3.1.28

Use Curated BLAST to search for 5.3.1.- or 5.3.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CXQ3 at UniProt or InterPro

Protein Sequence (196 amino acids)

>DZA65_RS01670 DnaA initiator-associating protein DiaA (Dickeya dianthicola ME23)
MLERIKVCFTESIQTQIAAAEALPDAISRAALAMVQSLLNGNKILCCGNGTSAANAQHFA
ASMINRFETERPSLPAIALNADNVVLTAIANDRLHEEVYAKQVRALGQAGDVLLAISTRG
NSRDIVKAVEAAVTRDMTIVALTGYDGGELAGLLGQQDVEIRIPSHRSARIQEMHMLTVN
CLCDLIDNTLFPHQND