Protein Info for DZA65_RS01595 in Dickeya dianthicola ME23

Annotation: cell division protein ZapE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF03969: AFG1_ATPase" amino acids 4 to 372 (369 residues), 496.9 bits, see alignment E=1.7e-153

Best Hits

Swiss-Prot: 65% identical to ZAPE_ECOLI: Cell division protein ZapE (zapE) from Escherichia coli (strain K12)

KEGG orthology group: K06916, (no description) (inferred from 97% identity to ddd:Dda3937_04446)

Predicted SEED Role

"ATPase, AFG1 family" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CZW0 at UniProt or InterPro

Protein Sequence (376 amino acids)

>DZA65_RS01595 cell division protein ZapE (Dickeya dianthicola ME23)
MQRTTPLALYQQALAAQTYQPDEVQHQTVVRLNAIHQMLTEQVWVQSESSAPGLMAKWRA
WLGQKEKSPSPVQGLYMWGGVGRGKTWLMDLFFHSLPSERKLRLHFHRFMLRVHEELNQL
QGQENPLEKVADGFKAQTDILCFDEFFVSDITDAMLLAELLRALFSRGIALVATSNIPPD
ELYRNGLQRARFLPAIALIKQHCDVLNVDAGIDYRLRTLTQAHLYLTPGNADTDAEMQAM
FRRLSGRDFSQPGPVLEINHRSLATLSAGDGVLAVDFATLCLEARSQNDYIALSRLYHTV
LLHHVPVMEVKDENAARRFLALVDEFYERRVKLVMSAQATMFEIYQGEHLKFEYQRCLSR
LQEMQSEEYLRQPHLP