Protein Info for DZA65_RS01590 in Dickeya dianthicola ME23

Annotation: DUF1043 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details PF06295: ZapG-like" amino acids 6 to 127 (122 residues), 170.3 bits, see alignment E=8.7e-55

Best Hits

Swiss-Prot: 78% identical to YHCB_ECO57: Putative cytochrome d ubiquinol oxidase subunit 3 (yhcB) from Escherichia coli O157:H7

KEGG orthology group: K09908, hypothetical protein (inferred from 96% identity to ddc:Dd586_0301)

Predicted SEED Role

"Putative cytochrome d ubiquinol oxidase subunit III (EC 1.10.3.-) (Cytochrome bd-I oxidase subunit III)" (EC 1.10.3.-)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D4R9 at UniProt or InterPro

Protein Sequence (134 amino acids)

>DZA65_RS01590 DUF1043 family protein (Dickeya dianthicola ME23)
MTWESALIGFVIGVIIGAVAMRFGNRKLRQQQVLQNELEKNKTELEEYRQELVSHFAHSA
ELLDNMARDYRQLYQHMAKSSNSLLPDVPMQDNPFRYRLTEAESDNDQAPVDMPPRDYSD
RASGLLRGTRPTGK