Protein Info for DZA65_RS01520 in Dickeya dianthicola ME23

Annotation: lipopolysaccharide ABC transporter substrate-binding protein LptA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR03002: lipopolysaccharide transport periplasmic protein LptA" amino acids 28 to 167 (140 residues), 161.6 bits, see alignment E=5.2e-52 PF03968: LptD_N" amino acids 38 to 149 (112 residues), 105.2 bits, see alignment E=2.5e-34

Best Hits

Swiss-Prot: 73% identical to LPTA_ECOL6: Lipopolysaccharide export system protein LptA (lptA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K09774, lipopolysaccharide export system protein LptA (inferred from 98% identity to ddd:Dda3937_00684)

MetaCyc: 73% identical to lipopolysaccharide transport system protein LptA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-237 [EC: 7.5.2.5]

Predicted SEED Role

"LptA, protein essential for LPS transport across the periplasm" in subsystem KDO2-Lipid A biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D0B6 at UniProt or InterPro

Protein Sequence (192 amino acids)

>DZA65_RS01520 lipopolysaccharide ABC transporter substrate-binding protein LptA (Dickeya dianthicola ME23)
MKSNQKINVLHSILIASSLFAVSIPALALTGDTDQPIHITSDQQALDMQGNVVTFIGNVI
VTQGSIKAQADKVVVTRPNGQQGHEVIEGYGNPATFYQMQDNGKPVKGHSQKMRYEMDKQ
LVILTGDAYLEQLDSNVKGDRITYLVQQQQMEAFSDKGKRVTTVLVPTQLQDKGAQNGAK
PGGNTGKPTKQQ