Protein Info for DZA65_RS01470 in Dickeya dianthicola ME23

Annotation: LysE family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 63 to 88 (26 residues), see Phobius details amino acids 123 to 140 (18 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details PF01810: LysE" amino acids 15 to 205 (191 residues), 116.1 bits, see alignment E=7.3e-38

Best Hits

KEGG orthology group: None (inferred from 98% identity to ddd:Dda3937_00674)

Predicted SEED Role

"Homoserine/homoserine lactone efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XSE4 at UniProt or InterPro

Protein Sequence (208 amino acids)

>DZA65_RS01470 LysE family transporter (Dickeya dianthicola ME23)
MTLHLWLVYAGVITALIAVPGPSALLSMTHGLRYGQRRALATVLGGATGSLVLMTASALG
LGAILAASATAFLALKVVGAAYLIWLGISAWRTRESTLTPSVEVEAIAPGLPTLYHRGFM
VGVSNPKDILFFAALFPNFIDTGAPQAMQFALLALTWVVLDCSIMFSYACMGNRVSALFA
HPRRLRLFNRATGTLLIFAGSALVASTK