Protein Info for DZA65_RS01455 in Dickeya dianthicola ME23

Annotation: p-hydroxybenzoic acid efflux pump subunit AaeA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 43 to 240 (198 residues), 109.3 bits, see alignment E=9.9e-36 PF25917: BSH_RND" amino acids 44 to 183 (140 residues), 53.2 bits, see alignment E=5.4e-18 PF25973: BSH_CzcB" amino acids 44 to 179 (136 residues), 36.4 bits, see alignment E=1e-12 PF25878: HH_AAEA_pHBA" amino acids 78 to 149 (72 residues), 116.9 bits, see alignment E=1.1e-37 PF25963: Beta-barrel_AAEA" amino acids 187 to 283 (97 residues), 154.9 bits, see alignment E=1.2e-49

Best Hits

Swiss-Prot: 76% identical to AAEA_PECAS: p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: None (inferred from 97% identity to ddd:Dda3937_00671)

MetaCyc: 72% identical to aromatic carboxylic acid efflux pump membrane fusion protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-233

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DIL3 at UniProt or InterPro

Protein Sequence (307 amino acids)

>DZA65_RS01455 p-hydroxybenzoic acid efflux pump subunit AaeA (Dickeya dianthicola ME23)
MIKKFSRMTMTLLLVLLAAVALVRAWSFYTESPWTRDARFSADVVAIAPDVSGLLTDVKV
QDNQPVKQGDVLFVIDQPRYQQALEQAQADVAYYQALADEKKRESARRQRLGVQAMSREE
IEQSGNALQTTLHQLAKAQAELELAKLDLARTVVRAPADGWITNLHVHAGEYITRGSTAV
ALVKKDSFYLLAYMEETKLAGVRSGYRVEITPLGSNQILFGTVDSIAAGVTNSSSSADTK
GLATVDSNLEWVRLAQRVPVKIHLERQWGDLYPAGTTATVVVTGEHTRNTKPMSPLLQLL
HRLREFG