Protein Info for DZA65_RS01450 in Dickeya dianthicola ME23

Annotation: AaeX family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 67 transmembrane" amino acids 6 to 32 (27 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details PF07869: DUF1656" amino acids 7 to 61 (55 residues), 61.8 bits, see alignment E=2.6e-21

Best Hits

Swiss-Prot: 82% identical to AAEX_PECAS: Protein AaeX (aaeX) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: None (inferred from 94% identity to dze:Dd1591_3827)

Predicted SEED Role

"probable membrane protein YPO3684"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CJM1 at UniProt or InterPro

Protein Sequence (67 amino acids)

>DZA65_RS01450 AaeX family protein (Dickeya dianthicola ME23)
MNSLPVMVLFGLSFPPVFFVLLVTLALFFICIRLLHPTGIYDLVWHPALFNTALFVCLFY
LLFRFGL