Protein Info for DZA65_RS01425 in Dickeya dianthicola ME23
Annotation: septum formation inhibitor Maf
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 74% identical to NTPPA_YERPA: dTTP/UTP pyrophosphatase (YPA_3681) from Yersinia pestis bv. Antiqua (strain Antiqua)
KEGG orthology group: K06287, septum formation protein (inferred from 96% identity to ddd:Dda3937_00665)MetaCyc: 64% identical to nucleoside triphosphate pyrophosphatase YhdE (Escherichia coli K-12 substr. MG1655)
Nucleotide diphosphatase. [EC: 3.6.1.9]; 3.6.1.9 [EC: 3.6.1.9]
Predicted SEED Role
"Septum formation protein Maf" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton
MetaCyc Pathways
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (14/14 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis II (7/7 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
- dZTP biosynthesis (3/5 steps found)
- pyrimidine deoxyribonucleotides dephosphorylation (1/3 steps found)
- tunicamycin biosynthesis (2/9 steps found)
KEGG Metabolic Maps
- Nicotinate and nicotinamide metabolism
- Pantothenate and CoA biosynthesis
- Purine metabolism
- Riboflavin metabolism
- Starch and sucrose metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.6.1.9
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A3A4CXB3 at UniProt or InterPro
Protein Sequence (197 amino acids)
>DZA65_RS01425 septum formation inhibitor Maf (Dickeya dianthicola ME23) MTDLYLASASPRRRELLTLLELPFAILKIDVAEQRQPDETPEQYVSRLARDKAAAGVAAA PVDLPVLGADTIVVLNGQVLEKPRDEDDAARILRALSGQRHQVMTALALADRRESVSARV VTEVQFRALSDDEITRYIASGEPMDKAGAYGIQGKGGCFVKSIFGSYHAVVGLPLVETLE LFTHFSARRKERGPHDR