Protein Info for DZA65_RS01425 in Dickeya dianthicola ME23

Annotation: septum formation inhibitor Maf

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 TIGR00172: septum formation protein Maf" amino acids 2 to 181 (180 residues), 204.5 bits, see alignment E=5.3e-65 PF02545: Maf" amino acids 4 to 184 (181 residues), 206 bits, see alignment E=2.1e-65

Best Hits

Swiss-Prot: 74% identical to NTPPA_YERPA: dTTP/UTP pyrophosphatase (YPA_3681) from Yersinia pestis bv. Antiqua (strain Antiqua)

KEGG orthology group: K06287, septum formation protein (inferred from 96% identity to ddd:Dda3937_00665)

MetaCyc: 64% identical to nucleoside triphosphate pyrophosphatase YhdE (Escherichia coli K-12 substr. MG1655)
Nucleotide diphosphatase. [EC: 3.6.1.9]; 3.6.1.9 [EC: 3.6.1.9]

Predicted SEED Role

"Septum formation protein Maf" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CXB3 at UniProt or InterPro

Protein Sequence (197 amino acids)

>DZA65_RS01425 septum formation inhibitor Maf (Dickeya dianthicola ME23)
MTDLYLASASPRRRELLTLLELPFAILKIDVAEQRQPDETPEQYVSRLARDKAAAGVAAA
PVDLPVLGADTIVVLNGQVLEKPRDEDDAARILRALSGQRHQVMTALALADRRESVSARV
VTEVQFRALSDDEITRYIASGEPMDKAGAYGIQGKGGCFVKSIFGSYHAVVGLPLVETLE
LFTHFSARRKERGPHDR