Protein Info for DZA65_RS01400 in Dickeya dianthicola ME23

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 121 to 138 (18 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 234 to 257 (24 residues), see Phobius details TIGR02823: putative quinone oxidoreductase, YhdH/YhfP family" amino acids 2 to 324 (323 residues), 452.9 bits, see alignment E=2.4e-140 PF08240: ADH_N" amino acids 27 to 114 (88 residues), 46.4 bits, see alignment E=4.1e-16 PF00107: ADH_zinc_N" amino acids 158 to 283 (126 residues), 57.4 bits, see alignment E=1.5e-19

Best Hits

Swiss-Prot: 70% identical to ACUI_ECOLI: Probable acrylyl-CoA reductase AcuI (acuI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to ddd:Dda3937_00660)

MetaCyc: 70% identical to acrylyl-CoA reductase (Escherichia coli K-12 substr. MG1655)
RXN-9087 [EC: 1.3.1.84]

Predicted SEED Role

"YhdH, a putative quinone oxidoreductase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.84

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CXV6 at UniProt or InterPro

Protein Sequence (328 amino acids)

>DZA65_RS01400 oxidoreductase (Dickeya dianthicola ME23)
MRALVLRQQDGLTLADVGAIEPSQLPDGDVIVDVDWSGINYKDALAITGKGKIIRQFPMV
PGIDFAGTVRHSNHPDVKAGQPVVLTGWGVGENHWGGLAEQARVRADWLVPLPQGLTPRQ
AMIIGTAGFTAMLCVMALEDGGVTPASGDVVVSGASGGVGSTAVALLHALGYQVTAVSGR
ADNSAYLQQLGAHQVLDRKAFATAGRPLEKQCWAGAIDTVGDQVLATLLTQMHYGATVAA
CGLAGGVSLPATVMPFILRNVRLQGVDSVMTPRARREEAWRRLATLLPAAFYEQVTQEIT
LEQVPAAAAALLENRVTGRTLVRVGAAD