Protein Info for DZA65_RS01350 in Dickeya dianthicola ME23
Annotation: DNA-binding transcriptional regulator Fis
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 99% identical to FIS_PECCP: DNA-binding protein Fis (fis) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)
KEGG orthology group: K03557, Fis family transcriptional regulator, factor for inversion stimulation protein (inferred from 99% identity to eoh:ECO103_4000)Predicted SEED Role
"DNA-binding protein Fis" in subsystem DNA structural proteins, bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A3A4CWA4 at UniProt or InterPro
Protein Sequence (98 amino acids)
>DZA65_RS01350 DNA-binding transcriptional regulator Fis (Dickeya dianthicola ME23) MFEQRVNSDVLTVSTVNSQAQVTQKPLRDSVKQALKNYFAQLNGQDVNDLYELVLAEVEQ PLLDMVMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN