Protein Info for DZA65_RS01290 in Dickeya dianthicola ME23

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 transmembrane" amino acids 28 to 48 (21 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 189 to 214 (26 residues), see Phobius details amino acids 227 to 245 (19 residues), see Phobius details amino acids 286 to 309 (24 residues), see Phobius details amino acids 327 to 345 (19 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 151 to 247 (97 residues), 69.4 bits, see alignment E=1.6e-23 PF00528: BPD_transp_1" amino acids 168 to 355 (188 residues), 87 bits, see alignment E=7.1e-29

Best Hits

Swiss-Prot: 80% identical to YHDY_ECOLI: Inner membrane amino-acid ABC transporter permease protein YhdY (yhdY) from Escherichia coli (strain K12)

KEGG orthology group: K09971, general L-amino acid transport system permease protein (inferred from 95% identity to dze:Dd1591_3859)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltK (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CH71 at UniProt or InterPro

Protein Sequence (362 amino acids)

>DZA65_RS01290 amino acid ABC transporter permease (Dickeya dianthicola ME23)
MTTHTPSNPTPINHAITWARRNLFSNITNSVLTLACLWLLWTLIPPLLNWAIFKADWVGS
TRADCTSDGACWVFIHARFEQFMYGLYPREELWRINFALVLALISILPMFWRNLPHRGRY
IAIWCVIYPFIAWWLLFGGFGGLTQVETRQWGGLTLTIIIAAIGIAGALPLGILLALGRR
SNMPVLRALCVIFIEFWRGVPLITVLFMSSVMLPLFLTEGTSIDKLLRALVGVILFQSAY
VAEVVRGGLQALPKGQYEAAQSLALGYWRMQGLVILPQALKMVIPGLVNTIIALFKDTSL
VIIIGLFDLFSSIQQATVDPAWLGMSTEGYVFAAILYWIFCFSMSRYSQHLEKRFDTGHK
SH