Protein Info for DZA65_RS01230 in Dickeya dianthicola ME23
Annotation: uroporphyrinogen decarboxylase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 92% identical to DCUP_PECAS: Uroporphyrinogen decarboxylase (hemE) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
KEGG orthology group: K01599, uroporphyrinogen decarboxylase [EC: 4.1.1.37] (inferred from 99% identity to ddd:Dda3937_00238)MetaCyc: 90% identical to uroporphyrinogen decarboxylase (Escherichia coli K-12 substr. MG1655)
Uroporphyrinogen decarboxylase. [EC: 4.1.1.37]
Predicted SEED Role
"Uroporphyrinogen III decarboxylase (EC 4.1.1.37)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.1.1.37)
MetaCyc Pathways
- superpathway of heme b biosynthesis from glutamate (10/10 steps found)
- superpathway of heme b biosynthesis from uroporphyrinogen-III (6/6 steps found)
- superpathway of heme b biosynthesis from glycine (7/8 steps found)
- heme b biosynthesis I (aerobic) (4/4 steps found)
- heme b biosynthesis II (oxygen-independent) (4/4 steps found)
- heme b biosynthesis V (aerobic) (4/4 steps found)
- heme b biosynthesis IV (Gram-positive bacteria) (1/5 steps found)
- 3,8-divinyl-chlorophyllide a biosynthesis I (aerobic, light-dependent) (3/9 steps found)
- 3,8-divinyl-chlorophyllide a biosynthesis II (anaerobic) (3/9 steps found)
- 3,8-divinyl-chlorophyllide a biosynthesis III (aerobic, light independent) (3/9 steps found)
- superpathway of bacteriochlorophyll a biosynthesis (6/26 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.1.1.37
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A3A4CZ40 at UniProt or InterPro
Protein Sequence (357 amino acids)
>DZA65_RS01230 uroporphyrinogen decarboxylase (Dickeya dianthicola ME23) MTDLKNDRYLRALLRQPVDITPVWMMRQAGRYLPEYRATRSQAGDFMSLCKNAELACEVT LQPLRRYNLDAAILFSDILTVPDAMGLGLYFEAGEGPRFTSPVTCHADVEKLAVPDPELE LGYVMNAVRTIRRNLAGAVPLIGFSGSPWTLATYMVEGGSSKAFTVIKKMMFAEPRTLHL LLDKLADSVTLYLNAQIRAGAQAVMIFDTWGGALSGADYREFSLHYMHKIVDGLQRENDG RRVPVTLFTKGGGQWLEAMADTGCDALGLDWTTDIADARRRVGDRVALQGNMDPSMLYAP PARIEQEVATILAGFGAGNGHVFNLGHGIHQDVPPEHAGAFVEAVHRLSAPYHQDLA