Protein Info for DZA65_RS01200 in Dickeya dianthicola ME23

Annotation: sulfur carrier protein ThiS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 66 PF02597: ThiS" amino acids 3 to 66 (64 residues), 52.5 bits, see alignment E=2.9e-18 TIGR01683: thiamine biosynthesis protein ThiS" amino acids 4 to 66 (63 residues), 60.3 bits, see alignment E=9e-21

Best Hits

Swiss-Prot: 56% identical to THIS_ECOLI: Sulfur carrier protein ThiS (thiS) from Escherichia coli (strain K12)

KEGG orthology group: K03154, sulfur carrier protein (inferred from 92% identity to ddd:Dda3937_00232)

MetaCyc: 56% identical to sulfur carrier protein ThiS (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Sulfur carrier protein ThiS" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D862 at UniProt or InterPro

Protein Sequence (66 amino acids)

>DZA65_RS01200 sulfur carrier protein ThiS (Dickeya dianthicola ME23)
MKVRLNDEVIELQDGLTVAQLLGQLERLQPGTALAINQTIIPRDAWAQHAMRDGDDILLF
QAIAGG