Protein Info for DZA65_RS00965 in Dickeya dianthicola ME23

Annotation: ubiquinone biosynthesis regulatory protein kinase UbiB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 545 transmembrane" amino acids 24 to 25 (2 residues), see Phobius details amino acids 499 to 518 (20 residues), see Phobius details amino acids 524 to 543 (20 residues), see Phobius details TIGR01982: 2-polyprenylphenol 6-hydroxylase" amino acids 6 to 445 (440 residues), 600.1 bits, see alignment E=1e-184 PF03109: ABC1" amino acids 93 to 343 (251 residues), 259.9 bits, see alignment E=9.2e-82

Best Hits

Swiss-Prot: 86% identical to UBIB_PECAS: Probable protein kinase UbiB (ubiB) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K03688, ubiquinone biosynthesis protein (inferred from 96% identity to ddd:Dda3937_02064)

Predicted SEED Role

"Ubiquinone biosynthesis monooxygenase UbiB" in subsystem Ubiquinone Biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CSC7 at UniProt or InterPro

Protein Sequence (545 amino acids)

>DZA65_RS00965 ubiquinone biosynthesis regulatory protein kinase UbiB (Dickeya dianthicola ME23)
MTPGELLRLYRIIGVLLSYGLDELIPRIPLTMPLRLWRCLLFWLPNRHKDKPLGERLRLA
LQELGPVWIKFGQMMSTRRDLFPPAIANQLAMLQDQVAPFDGELARQQIETSMGGKLETW
FDDFDATPLASASIAQVHTARLKTTGKDIVIKVIRPDILPVIKADMRLMNRLAGWLPILL
PDGRRLRPREVVRDYEKTLLDELNLLREAANAIQLRRNFENSPMLYVPEIYSDYCNERVL
VMERIYGIPVSDVEALKRHGINMPLLAERGVQVFFTQVFRDSFFHADMHPGNIFISYEHP
EDPQYIGIDCGIVGSLNKDDKRYLAENFIAFFNRDYRRVAELHVDSGWVPQDTNVEEFEF
AIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYIEGVGRQLYP
QLDLWKTAKPFLETWLKDQVGLPAILRAFKEKAPFWAEKLPEIPELFYDSLRQHKMLKQN
MALLTGELRTQRTRHGRARYLLGVGATLLLSGTILLVSRVEADVVPAGLIAAGFVAWIVG
WRCTR