Protein Info for DZA65_RS00945 in Dickeya dianthicola ME23

Annotation: argininosuccinate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 TIGR00838: argininosuccinate lyase" amino acids 3 to 456 (454 residues), 695.6 bits, see alignment E=1.7e-213 PF00206: Lyase_1" amino acids 6 to 301 (296 residues), 329.6 bits, see alignment E=2.3e-102 PF14698: ASL_C2" amino acids 364 to 432 (69 residues), 97.7 bits, see alignment E=4.1e-32

Best Hits

Swiss-Prot: 91% identical to ARLY_PECCP: Argininosuccinate lyase (argH) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K01755, argininosuccinate lyase [EC: 4.3.2.1] (inferred from 97% identity to dze:Dd1591_3917)

MetaCyc: 86% identical to argininosuccinate lyase (Escherichia coli K-12 substr. MG1655)
Argininosuccinate lyase. [EC: 4.3.2.1]

Predicted SEED Role

"Argininosuccinate lyase (EC 4.3.2.1)" in subsystem Arginine Biosynthesis extended (EC 4.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XS99 at UniProt or InterPro

Protein Sequence (457 amino acids)

>DZA65_RS00945 argininosuccinate lyase (Dickeya dianthicola ME23)
MALWGGRFTQAADTRFKQFNDSLRFDYRLAEQDIIGSIGWSKALVTVNVLSAQEQQQLEQ
ALNALLTEVQADPEAILQSDAEDIHSWVEQKLIEKVGDLGKKLHTGRSRNDQVATDLKLW
CKAQVSELAQAIRHLRAALVATAEANQDAVMPGYTHLQRAQPVTFAHWCLAYHDMLSRDE
SRLEDTLTRLDVSPLGCGALAGTAYPIDREQLAGWLGFASATRNSLDTVSDRDHVLELLS
DASIGMVHLSRFAEDLIFFNSGEAAFVELSDRVTSGSSLMPQKKNPDALELIRGKCGRVQ
GALAGMLVTLKGLPLAYNKDMQEDKEGLFDALDTWHDCLMMAALVLEGIQVKRPRCQEAA
QQGYANATELADYLVAKGVPFREAHHIVGEAVVEAIRQGKSLEALSLADLKQFSAVIEDD
VYPVLSLQSCLEKRAAQGGVSPQQVARAIADAKQRLA