Protein Info for DZA65_RS00910 in Dickeya dianthicola ME23

Annotation: ThiF family adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 transmembrane" amino acids 319 to 340 (22 residues), see Phobius details PF00899: ThiF" amino acids 115 to 373 (259 residues), 106.1 bits, see alignment E=8.3e-35

Best Hits

KEGG orthology group: None (inferred from 97% identity to dze:Dd1591_3925)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XWM6 at UniProt or InterPro

Protein Sequence (377 amino acids)

>DZA65_RS00910 ThiF family adenylyltransferase (Dickeya dianthicola ME23)
MYNEVYKIKDTVDIFISENEHDSTVTLNFHIMTTRDRIEIKTNKHVARFIASFDGEKNLS
EIVSEIGNLKSEDVIKLIEFLLNQHLIFNVAHPIHDDLRFSRQITFWDDFVLDRPGQETQ
AILENKKIVLFGCGAVGAKIIDILARAGINHITLIDYKIMSEASAVRHNYYSYKRVGEPK
VDVLSDFLARINKNIFIKKHFEKLMPDSDLSKLIPDDTDLIINTCDEPYIGHTSLKLGRY
AQSKKIPLYVAGGFDAHLMSSGELINPPKTPCIDCAQNTFSRALKGWKPVYSMIENPHSF
ASTPVNVENNNYISGGPGGLAIMSGFSASLCCMQLLHFLLDDSAFTYQNRRYEYLPNSGN
MTQFELAKQDGCEICNG