Protein Info for DZA65_RS00880 in Dickeya dianthicola ME23

Annotation: dienelactone hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF02129: Peptidase_S15" amino acids 46 to 250 (205 residues), 24.1 bits, see alignment E=8.1e-09 PF01738: DLH" amino acids 50 to 272 (223 residues), 238.3 bits, see alignment E=2.3e-74 PF02230: Abhydrolase_2" amino acids 130 to 245 (116 residues), 29.8 bits, see alignment E=1.7e-10 PF00326: Peptidase_S9" amino acids 188 to 272 (85 residues), 26.1 bits, see alignment E=1.7e-09

Best Hits

Swiss-Prot: 74% identical to DLHH_SALTY: Putative carboxymethylenebutenolidase (ysgA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01061, carboxymethylenebutenolidase [EC: 3.1.1.45] (inferred from 98% identity to dze:Dd1591_3933)

Predicted SEED Role

"Putative carboxymethylenebutenolidase (EC 3.1.1.45)" (EC 3.1.1.45)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XSU6 at UniProt or InterPro

Protein Sequence (275 amino acids)

>DZA65_RS00880 dienelactone hydrolase family protein (Dickeya dianthicola ME23)
MKTDALLTLRETTRAFSPAVMPLASSAMTTDAAGLVAGETTIPSQGDSLPAYIAKPEKTD
GPLPIVLVVQEIFGVHEHIRDVCRRLAKQGYLAIAPELYFRQGDPQQYSDIPTLMRELVS
KVPDNQILSDLDHTAHWAVRQGGDASRLAITGFCWGGRISWLYAAHNPQLKAAVAWYGKL
VAEKTLTSPQHPVDVAKDLSAPVLGLYGGQDKSIPPEQVETMRQALRAVNADAEIVVYPD
ADHAFHADYRATYHEASAKDGWQRMLAWFARYGVV