Protein Info for DZA65_RS00845 in Dickeya dianthicola ME23

Annotation: protein-export chaperone SecB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 TIGR00809: protein-export chaperone SecB" amino acids 6 to 143 (138 residues), 222.2 bits, see alignment E=1.1e-70 PF02556: SecB" amino acids 7 to 144 (138 residues), 192.5 bits, see alignment E=1.6e-61

Best Hits

Swiss-Prot: 89% identical to SECB_PECCP: Protein-export protein SecB (secB) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K03071, preprotein translocase subunit SecB (inferred from 97% identity to ddd:Dda3937_02047)

Predicted SEED Role

"Protein export cytoplasm chaperone protein (SecB, maintains protein to be exported in unfolded state)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CSY8 at UniProt or InterPro

Protein Sequence (156 amino acids)

>DZA65_RS00845 protein-export chaperone SecB (Dickeya dianthicola ME23)
MSEQNNGELTFQIQRIYTKDISFEAPNAPQVFQQEWNPEVKLDLDTASTQLADDVYEVVL
RVTVTSTLGEETAFLCEVQQAGIFTVGGIEGTQLAHCLGAYCPNVLFPYARECITSLVSR
GTFPQLNLAPVNFDALFMNYLEQQTGQDGTAQTLDA