Protein Info for DZA65_RS00835 in Dickeya dianthicola ME23

Annotation: murein hydrolase activator EnvC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details PF01551: Peptidase_M23" amino acids 325 to 418 (94 residues), 99.4 bits, see alignment E=5.4e-33

Best Hits

Swiss-Prot: 66% identical to ENVC_ECOLI: Murein hydrolase activator EnvC (envC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to ddd:Dda3937_02045)

MetaCyc: 66% identical to murein hydrolase activator EnvC (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Cell wall endopeptidase, family M23/M37"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DPE5 at UniProt or InterPro

Protein Sequence (424 amino acids)

>DZA65_RS00835 murein hydrolase activator EnvC (Dickeya dianthicola ME23)
MSKKAFSVPLPTGRDKLLIRCASVLCVGVLLLPCPGWSDDGQQQLKSLQQDIAEKEKSVR
EQQQRRSALLDQLKKQEQSIAQSTRQLRDTRSTLERLNQDVGGLNASIATLQTQQKTQET
LLAKQLDAAFRQGQHGALQLILSGEESQRRERILAYFNYLNQAREQSITALQQTRTQLAG
QKQQLEQKQAQQKRLLGDQQQQQKTLEQAQGERQKTLGALENALEKDQQQLTELRQNETR
LRDQIARAEREAKARAEREAREAARLREKEEQAKRSGASYKPTEQERSLMARTGGLGQPA
GQYVWPVRGRTLHRFGEPLQGELRWKGLVIGSSEGTEVRAIADGTVLMADWLQGYGQVVV
LEHGKGDMSLYGYNQSALVSVGAQVKAGQPVALVGNSGGQNQPALYFEIRRQGQAVNPLP
WLGR