Protein Info for DZA65_RS00780 in Dickeya dianthicola ME23

Annotation: glycosyltransferase family 2 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 199 to 216 (18 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 7 to 144 (138 residues), 59.9 bits, see alignment E=1.5e-20

Best Hits

Swiss-Prot: 74% identical to KDTX_SERMA: Lipopolysaccharide core biosynthesis glycosyltransferase KdtX (kdtX) from Serratia marcescens

KEGG orthology group: K12984, (heptosyl)LPS beta-1,4-glucosyltransferase [EC: 2.4.1.-] (inferred from 96% identity to ddd:Dda3937_02032)

Predicted SEED Role

"Putative two-domain glycosyltransferase" in subsystem LOS core oligosaccharide biosynthesis

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DPF6 at UniProt or InterPro

Protein Sequence (263 amino acids)

>DZA65_RS00780 glycosyltransferase family 2 protein (Dickeya dianthicola ME23)
MSRKRLSAVLISHNAAELLPDCLASVGWADEIIVLDSGSSDGTLDVARRHGALVYQNTDW
PGFGKQRQLAQQYASGDYIFMIDTDERVTPALRQSIEATLESPESDAVYRCARRNLFLGR
FMRHSGWYPDEVIRLYPNRYRYNDDAVHESLDYGDARVISLDGDLKHLTCRDFFSFQQKQ
FAYAESWATERFRLGKRCGFAAIVLHTLGAFVKTWLLRAGFLDGKQGLLLAIVNAQYTFN
KYTGLWALNNRRDTHQEHQHHED