Protein Info for DZA65_RS00740 in Dickeya dianthicola ME23

Annotation: nucleoid occlusion factor SlmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 PF00440: TetR_N" amino acids 25 to 61 (37 residues), 34.1 bits, see alignment 2e-12 PF22276: SlmA-like_C" amino acids 82 to 198 (117 residues), 164.8 bits, see alignment E=7.8e-53

Best Hits

Swiss-Prot: 92% identical to SLMA_PECAS: Nucleoid occlusion factor SlmA (slmA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K05501, TetR/AcrR family transcriptional regulator (inferred from 98% identity to dze:Dd1591_3963)

Predicted SEED Role

"Transcriptional regulator SlmA, TetR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CV94 at UniProt or InterPro

Protein Sequence (198 amino acids)

>DZA65_RS00740 nucleoid occlusion factor SlmA (Dickeya dianthicola ME23)
MAEKENTKRNRREEILQALAQMLESSDGSQRITTAKLAATVGVSEAALYRHFPSKTRMFD
SLIEFIEDSLTTRINLIMQDEKDTFNRLRLILLLILGFAEKNPGLTRILTGHALMFEQDR
LQGRINQLFDRIESQLRQVLREHKLRSGEAFRHDETLLASQLLAFCEGMLSRFTRSEFRT
LPTQDFDTRWPLLAAQLQ