Protein Info for DZA65_RS00735 in Dickeya dianthicola ME23
Annotation: orotate phosphoribosyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 88% identical to PYRE_PECCP: Orotate phosphoribosyltransferase (pyrE) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)
KEGG orthology group: K00762, orotate phosphoribosyltransferase [EC: 2.4.2.10] (inferred from 96% identity to ddc:Dd586_0145)MetaCyc: 87% identical to orotate phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Orotate phosphoribosyltransferase. [EC: 2.4.2.10]
Predicted SEED Role
"Orotate phosphoribosyltransferase (EC 2.4.2.10)" in subsystem De Novo Pyrimidine Synthesis (EC 2.4.2.10)
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
- superpathway of pyrimidine ribonucleotides de novo biosynthesis (9/9 steps found)
- UMP biosynthesis I (6/6 steps found)
- UMP biosynthesis II (6/6 steps found)
- UMP biosynthesis III (5/6 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.4.2.10
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A3A4D351 at UniProt or InterPro
Protein Sequence (213 amino acids)
>DZA65_RS00735 orotate phosphoribosyltransferase (Dickeya dianthicola ME23) MKAYQRQFIEFALSKQVLKFGEFTLKSGRTSPYFFNAGLFNTGRDLALLGRFYAEALVDA NVAFDVLFGPAYKGIPIATTTAVALAEHHDRDVPYCFNRKEAKDHGEGGNLVGSPLKGRI MLVDDVITAGTAIRESMEIIAAQGATLAGVLIALDRQERGRSELSAIQEVERDYQCKVTS IITLGDLIVWLAEKPEMAVHLEAVNAYRAQFGV