Protein Info for DZA65_RS00710 in Dickeya dianthicola ME23

Annotation: L-Ala-D/L-Glu epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 PF02746: MR_MLE_N" amino acids 9 to 109 (101 residues), 37.6 bits, see alignment E=2.3e-13 PF13378: MR_MLE_C" amino acids 133 to 295 (163 residues), 99 bits, see alignment E=3.4e-32

Best Hits

Swiss-Prot: 48% identical to AEEP_ECOLI: L-Ala-D/L-Glu epimerase (ycjG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to ddd:Dda3937_03253)

MetaCyc: 48% identical to L-Ala-D/L-Glu epimerase (Escherichia coli K-12 substr. MG1655)
RXN0-5228 [EC: 5.1.1.20]

Predicted SEED Role

"Muconate cycloisomerase (EC 5.5.1.1)" in subsystem Catechol branch of beta-ketoadipate pathway or Muconate lactonizing enzyme family (EC 5.5.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.20 or 5.5.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CVQ7 at UniProt or InterPro

Protein Sequence (321 amino acids)

>DZA65_RS00710 L-Ala-D/L-Glu epimerase (Dickeya dianthicola ME23)
MRQMQIEIVELPLARPFAISRGTRTAVTVVRVTLEERGFIGRGECTPTAHYQETADSVTR
QLETVRRVVENGLGLDALQRLLPPGSARNALDCALWRLNAALARQTLWQHLAIAPPQSIV
TAETLSLDSVENMANAAKDAVSRGALLLKIKLDREQILEKVAAIRQSAPNVTLIVDANEA
WSGLELEPLLRQLAAHRIAMVEQPLPAGQDSALATFEHAIAVCADESCHHRGDIAALRDR
YEMINIKLDKCGGLTEALAMVAQARQYGLRIMVGCMLGSSLAMEAAMPAALAAEHVDLDG
PIWLAADSSPYLTYNLGRIWL