Protein Info for DZA65_RS00675 in Dickeya dianthicola ME23

Annotation: isoaspartyl peptidase/L-asparaginase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 PF01112: Asparaginase_2" amino acids 3 to 312 (310 residues), 398.6 bits, see alignment E=9.3e-124

Best Hits

Swiss-Prot: 65% identical to IAAA_SALTY: Isoaspartyl peptidase (iaaA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K13051, beta-aspartyl-peptidase (threonine type) [EC: 3.4.19.5] (inferred from 98% identity to ddd:Dda3937_03246)

MetaCyc: 65% identical to isoaspartyl dipeptidase proenzyme (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Isoaspartyl aminopeptidase (EC 3.4.19.5) @ Asp-X dipeptidase" (EC 3.4.19.5)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.19.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XSP7 at UniProt or InterPro

Protein Sequence (322 amino acids)

>DZA65_RS00675 isoaspartyl peptidase/L-asparaginase (Dickeya dianthicola ME23)
MKPVIVIHGGAGALSRTAMDSEKEQRYRAALQSIVARGQAILAANGSALDAVTEAVRLLE
ECPLFNAGKGSVFTHRGTHELDASIMDGRSLEAGAIAGVNHIRNPILAARAVLERSPHVM
FTADGAETFAREQGLEMVEPDFFSTDERYQQLLKAQTGDGKILLDHDGERQAQSADPLDP
DRKFGTVGAVALDAAGNLAAATSTGGMTNKRAGRVGDSPIIGAGCYANNRTVAVSCTGTG
EVFMRTVAAYDVSALMEYGNLPLSQAADTVVMEKVLALGGSGGLIAVDRHGNIALPFNSE
GMYRGYGYVGEEAVVGIYRANT