Protein Info for DZA65_RS00670 in Dickeya dianthicola ME23

Annotation: HlyD family efflux transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF13533: Biotin_lipoyl_2" amino acids 67 to 112 (46 residues), 39.5 bits, see alignment 7.7e-14 PF16576: HlyD_D23" amino acids 183 to 312 (130 residues), 33.2 bits, see alignment E=6.4e-12 PF13437: HlyD_3" amino acids 229 to 337 (109 residues), 44.7 bits, see alignment E=3.9e-15

Best Hits

KEGG orthology group: None (inferred from 79% identity to ddc:Dd586_0129)

Predicted SEED Role

"Unknown, probable transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DEX5 at UniProt or InterPro

Protein Sequence (420 amino acids)

>DZA65_RS00670 HlyD family efflux transporter periplasmic adaptor subunit (Dickeya dianthicola ME23)
MIKVMTRKQRALALGAVVLAVSVAWLPFRQSDTDAAGGTQAQWVRIEPQRLENQLGLVGQ
IQAATRITLAAPFEGVVRDVRIHEGQRVDKDQILLTLDPAQLEIHMRQAQADVLKVQREV
QQFRHWDNSADVARSRRAVANARQTLSNTEASLRDTQTLFERGIVARMEVDILAQQERTQ
RQDLIVAQEELATILARGQGEERKIAEMELINAQARYQALEAMYARREVTAPVAGFIVRP
VTPENSKPVIVQPGMQVAQGTPLLTIIGQDRFQVLTRVEETDLHLLQEGMPVQITGDGFA
GRVLTGRIASIAVQGNTTDAQSAGANYDVVVSIDGALSDLRQPVRLGMSARLAVILHRNE
QGIAVPPEALQTDEQGLSYVLYRATPDAPTSKVSVTLGQSVVQGVEVQGVKAGFVQVFAR